| Draft for Information Only 
English Vocabulary: sSaanichSaarbrückenSabadellSabáraSabhasablesabotageSabzewarsackSacramento, CaliforniasacredsacrificesadsaddensaddleSadiqabadsadlysafe   safe" is something which is a collection of something that are gathered together for a journey in flight. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015safelysafetySafiSagaSagamiharaSagarSagay CitySaguenaySaharanpurSahiwalSaidaSaidpursailsailor   A person who is a working member of the crew of a ship. last updated 21 Mar 2015http://en.wikipedia.org/wiki/Sailor
 last updated 21 Mar 2015Saint JohnSaint LouisSaint PetersburgSaint-DenisSaint-ÉtienneSaint-PaulSakai, OsakaSakatasakeSakura, Chibasalad bowl   A large deep bowl that is usually a round bowl in deep shape of eight to nine inches in diameter, and is used to mix and serve a salad, especially a tossed salad. last updated 07 Jan 2016https://en.wikipedia.org/wiki/Bowl
 last updated 07 Jan 2016   A small bowl that is usually a round bowl of four to five inches in diameter, and is used to serve salad for individual. last updated 08 Jan 2016https://en.wikipedia.org/wiki/Bowl
 last updated 08 Jan 2016salad fork   A fork that is usually a short flat and broad four-tined fork of about 6 inches long, and is used in eating salad or pastry. last updated 28 Jan 2016https://en.wikipedia.org/wiki/Fork
 last updated 28 Jan 2016Salamancasalamander   A small urodele amphibians that has an elongated body, soft skin, bright markings, and lives both on land and in water. last updated 01 Jan 2016https://en.wikipedia.org/wiki/Salamander
 last updated 01 Jan 2016salarySalavatsaleSaléSalemSalem, OregonSalernosalesmanSalihorskSalinas, Californiasalmon   A fish that is a large edible fish with a silvery body, soft fin and pink flesh, and lives in the sea and swims up rivers to produce eggs. last updated 18 Mar 2015http://en.wikipedia.org/wiki/Salmon
 last updated 18 Mar 2015salt   A natural white 'mass' substance that is a natural formed crystalline mineral found in the ground or present in sea water as a solute. last updated 21 Dec 2015https://en.wikipedia.org/wiki/Salt
 last updated 21 Dec 2015Salt Lake City, Utahsalt shaker   A small container that is a condiment holder of salt with a perforated top, usually one hole, for sprinkling salt and is used for distributing grains of edible salt at the table. last updated 08 Jan 2016SaltaSaltillosaltySalvadorSalvadoreanSalzburgSalzgitterSamaraSamarindasamarium   A 'mass' thing this a chemical element of symbol Sm, atomic number 62, and atomic weight 150.4. last updated 16 Feb 2015http://en.wikipedia.org/wiki/Samarium
 last updated 16 Feb 2015SamarkandSambalpurSambhalsamesampleSamsunSamuel   A name that is used as a given name to name a male person at birth as a part of one's full name and is not the family name. last updated 27 Feb 2015http://en.wikipedia.org/wiki/Samuel_(name)
 last updated 27 Feb 2015San Antonio, TexasSan Bernardino, CaliforniaSan BernardoSan Buenaventura, CaliforniaSan Carlos City, Negros OccidentalSan Carlos City, PangasinanSan CristóbalSan Cristóbal de Las CasasSan Diego, CaliforniaSan Fernando City, La UnionSan Fernando City, PampangaSan Fernando del Valle de CatamarcaSan Francisco CoacalcoSan Francisco, CaliforniaSan JoséSan Jose City, Nueva EcijaSan Jose del Monte CitySan Jose, CaliforniaSan Jose, Occidental MindoroSan Juan City, Metro ManilaSan Juan, ArgentinaSan Juan, Puerto RicoSan LorenzoSan LuisSan Luis PotosíSan MartinSan Mateo, RizalSan MiguelSan Miguel de TucumánSan Miguel, BulacanSan MiguelitoSan NicolásSan Nicolás de los GarzasSan Pablo CitySan Pedro de MacorisSan Pedro SulaSan Pedro, LagunaSan RafaelSan SalvadorSan Salvador de JujuySan SebastiánSana'aSanandajSancti Spíritussand   A naturally occurring granular  'mass' substance that is the very tiny, loose grains of rock or finely divided rock and mineral particles. last updated 21 Dec 2015https://en.wikipedia.org/wiki/Sand
 last updated 21 Dec 2015SandaSandakansandalssandpaper   sandpaper" is something which is a tool with a strong paper and abrasive substance of different grit sizes that is used for smoothing and polishing other surface is coated on one side. last updated 18 Feb 2015http://en.wikipedia.org/wiki/Sandpaper
 last updated 18 Feb 2015sandpiper   sandpiper" is something which is a bird that is a wading shore bird with a long slender bill and long legs and cryptic plumage, and lives near the sea. last updated 22 Mar 2015http://en.wikipedia.org/wiki/Sandpiper
 last updated 22 Mar 2015SangliSanmenxiaSanmingSanta Ana, CaliforniaSanta Bárbara d'OesteSanta ClaraSanta Clara, CaliforniaSanta Clarita, CaliforniaSanta Coloma de GramanetSanta Cruz de la SierraSanta Cruz de TenerifeSanta Cruz do SulSanta Cruz, LagunaSanta FeSanta Fe de BogotáSanta Luzia, Minas GeraisSanta Maria, BulacanSanta Maria, CaliforniaSanta MartaSanta RitaSanta Rosa CitySanta Rosa, CaliforniaSantanderSantarém, BrazilSantiagoSantiago CitySantiago de CubaSantiago de los CaballerosSantiago del EsteroSantipurSanto AndréSanto DomingoSanto Domingo de los ColoradosSanto Tomas, BatangasSantosSanyaSão Bernardo do CampoSão Caetano do SulSão CarlosSão GonçaloSão João de MeritiSão JoséSão José de RibamarSão José do Rio PretoSão José dos CamposSão José dos PinhaisSão LeopoldoSão LuísSão PauloSão VicenteSapporoSapucaia do SulSaqezSaraburiSarah   A name that is used as a given name to name a female person at birth as a part of one's full name and is not the family name. last updated 27 Feb 2015http://en.wikipedia.org/wiki/Sarah_(given_name)
 last updated 27 Feb 2015SarajevoSaranskSarapulSaratovsardine   sardine" is something which is a fish that is a small marine food fish of young pilchard or other young or small herring-like fish, and is usually used for food amd is packed in a can. last updated 22 Mar 2015http://en.wikipedia.org/wiki/Sardine
 last updated 22 Mar 2015Sar-e PolSargodhaSariSariaya, QuezonSariwonSaseboSaskatoonSassarisassysatellite   A physical device that is sent up into space and placed in orbit around the earth, moon, sun, or a planet for specific function such as collecting information, communication, etc . last updated 14 Apr 2015http://en.wikipedia.org/wiki/Satellite
 last updated 14 Apr 2015satisfactionsatisfactorysatisfiedsatisfysatisfyingSatnaSatu MareSaturn   A physical planet of the eight planets in the Solar System which is the sixth planet in order of distance from the Sun after the Jupiter and before Uranus. last updated 14 Apr 2015http://en.wikipedia.org/wiki/Saturn
 last updated 14 Apr 2015saucesaucer   A small dish that is a shallow round plate of four to eight inches in diameter, and is used for resting a companion cup. last updated 08 Jan 2016https://en.wikipedia.org/wiki/Saucer
 last updated 08 Jan 2016SaudisaultSavannah, Georgiasavesavingsavorysaw   saw" is something which is a tool with a narrow toothed blade that is used for cutting. last updated 18 Feb 2015http://en.wikipedia.org/wiki/Saw
 last updated 18 Feb 2015sawtsaySayamascaldingscalescallop   A bivalve mollusc that has a flat, ribbed, round fan-shaped shell of two parts. last updated 30 Dec 2015https://en.wikipedia.org/wiki/Scallop
 last updated 30 Dec 2015scalyscandalousscandium   A 'mass' thing this a chemical element of symbol Sc, atomic number 21, and atomic weight 44.96. last updated 16 Feb 2015http://en.wikipedia.org/wiki/Scandium
 last updated 16 Feb 2015scarcescarcelyscarescarecrowscaredscarfscarilyscaryscatterscatteredscenesceneryscentscentedscheduleschool   school" is something which is a collection of something that are gathered together with discipline as in a school. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015Schwerinsciencescientificscientist   A person who studies or works in the natural or physical sciences using scientific methods last updated 22 Feb 2015http://en.wikipedia.org/wiki/Scientist
 last updated 22 Feb 2015scintillatingscissorsscold   scold" is something which is a collection of something that are gathered together with loud noise like scolding one another. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015scoldingscoopscorchscoresscornscorpion   A small insect-like creature that has a long segmented body, two front lobster-like pincers and a curved tail with a poisonous sting at the end. last updated 03 Jan 2016https://en.wikipedia.org/wiki/Scorpion
 last updated 03 Jan 2016Scottsdale, Arizonascourgescrapscrapescraper   scraper" is something which is a tool with a flexible flat blunt blade and a handle used for lifting, mixing, spreading, stirring on a surface. last updated 18 Feb 2015http://en.wikipedia.org/wiki/Putty_knife
 last updated 18 Feb 2015scratchscratchyscrawnyscreamscreamingscreechingscreenscrew   screw" is something which is a long thin straight pin with a raised helical thread running around for cutting into other things, and a shaped head at one end used for driving. last updated 18 Feb 2015http://en.wikipedia.org/wiki/Screw
 last updated 18 Feb 2015screwdriver   screwdriver" is something which is a tool with a shaped metal rod at the tip to fit into the head of a screw for turning at one end and a handle on the other end for holding to drive a screw. last updated 18 Feb 2015http://en.wikipedia.org/wiki/Screwdriver
 last updated 18 Feb 2015scribblescrubscryseaseaborgium   A 'mass' thing this a chemical element of symbol Sg, atomic number 106, and atomic weight (). last updated 16 Feb 2015http://en.wikipedia.org/wiki/Seaborgium
 last updated 16 Feb 2015seafowl   seafowl" is something which is a bird that is a seabird living on or near the sea. last updated 20 Mar 2015http://en.wikipedia.org/wiki/Seabird
 last updated 20 Mar 2015seagull   seagull" is something which is a bird that is a large web-footed aquatic bird with long pointed wings, short legs, and a mostly gray and white plumage, and lives near the ocean. last updated 25 Mar 2015http://en.wikipedia.org/wiki/Gull
 last updated 25 Mar 2015seahorse   seahorse" is something which is a fish that is small marine teleost fish with a segmented bony-plated body, a horselike head, a tubular snout, a prehensile tail, and swims in an upright or vertical position. last updated 24 Mar 2015http://en.wikipedia.org/wiki/Seahorse
 last updated 24 Mar 2015seal   seal" is something which is an animal that is a large carnivorous marine mammal with limbs modified into webbed flippers for swimming, and lives mainly in cold regions. last updated 20 Mar 2015http://en.wikipedia.org/wiki/Pinniped
 last updated 20 Mar 2015Seam Reabseamstress   seamstress" is somebody who is a female person that sews and makes clothes, curtains, etc, especially as a professional or an occupation. last updated 27 Mar 2015http://en.wikipedia.org/wiki/Dressmaker
 last updated 27 Mar 2015searchsearchinglyseashoreseasonseatSeattlesecondsecond-handsecrecysecretsecretary   A person who carries out administrative tasks or does general clerical work in an office. last updated 23 Feb 2015http://en.wikipedia.org/wiki/Secretary
 last updated 23 Feb 2015secretivesecuresecuritysedatesedatelysedgeseeseedseekseekingseemseeminglyseemlyseizeSekondi-Takoradiseldomselectselectionselectiveselenium   A 'mass' thing this a chemical element of symbol Se, atomic number 34, and atomic weight 78.96(3). last updated 16 Feb 2015http://en.wikipedia.org/wiki/Selenium
 last updated 16 Feb 2015Seleyang BaruselfselfishselfishlysellSemarangSemipalatinskSenatesenator   A person who is a elected politician as a member of a senate or the Senate. last updated 24 Mar 2015http://en.wikipedia.org/wiki/Senate
 last updated 24 Mar 2015sendSendaiSenegal   A proper name that is used to name a country, officially the Republic of Senegal, in west Africa. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Senegal
 last updated 26 Jan 2016senilesensesensitivesentence   sentence" is something which is a collection of something that are gathered together with character of given a judge. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015SeongnamSeoulseparateseparatelyseparationSeramporeSerbia   A proper name that is used to name a country, officially the Republic of Serbia, in southeastern Europe. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Serbia
 last updated 26 Jan 2016SerembanSergiyev PosadseriesseriousseriouslyserpentineSerpukhovSerraSertaozinhoservant   A person who is employed or hird to work  in someone's house especially doing or performing household or personal duties such as cleaning and cooking for someone else or as a personal attendant. last updated 26 Mar 2015http://en.wikipedia.org/wiki/Domestic_worker
 last updated 26 Mar 2015serveserveralserviceserving bowl   A large bowl that is usually a round bowl in deep shape of eight to nine inches in diameter,  and is used to serve soft foods, such as rice, pasta, mashed potatoes, or creamed foods. last updated 08 Jan 2016https://en.wikipedia.org/wiki/Bowl
 last updated 08 Jan 2016   A large shallow bowl that is usually a lowered round bowl of eight to nine inches in diameter with a broad, flat base and sloping sides and is used to serve firm foods, such as fruit, asparagus, and rolls. last updated 08 Jan 2016https://en.wikipedia.org/wiki/Bowl
 last updated 08 Jan 2016serving cart   A wheeled vehicle that is a cart used for serving food, and can be pushed by a person. last updated 08 Jan 2016serving platter   A large dishware that is a shallow dish or tray with a flat base made in oval, rectangular, round, or square shapes etc, and is used to display and serve meat course, such as sliced meat, or assorted cold foods, such as sliced fruit, vegetables, sandwiches, cake, or cookies, especially on a buffet. last updated 08 Jan 2016https://en.wikipedia.org/wiki/Platter_%28dishware%29
 last updated 08 Jan 2016setSete LagoasSetifSetosettleSevastopolseveralsevereSeverodvinskSeverskSevillesewsexSfaxshad   shad" is something which is a fish that a herring-like food fishh with a relatively deep body . last updated 27 Mar 2015http://en.wikipedia.org/wiki/Alosinae
 last updated 27 Mar 2015shadeshadowshadowyshaggyShah AlamShaheShahjahanpurShahrekordShahrudshakeShakespeareanShakhtyshakilyshakyshallshallowshameshampoo   The 'mass' thing of a special liquid preparation that is used for washing the hair. last updated 25 Dec 2015https://en.wikipedia.org/wiki/Shampoo
 last updated 25 Dec 2015ShanghaiShangluoShangqiuShangraoShangzhiShantouShanweiShaoguanShaowuShaoxingShaoyangshapeshareSharjahshark   A fish that is a ferocious selachian fish with a long fusiform body, tooth-like scales, two dorsal fins, rows of sharp teeth, and between five and seven gill slits on each side of the head last updated 26 Mar 2015http://en.wikipedia.org/wiki/Shark
 last updated 26 Mar 2015Sharon   A name that is used as a given name to name a female person at birth as a part of one's full name and is not the family name. last updated 27 Feb 2015http://en.wikipedia.org/wiki/Sharon
 last updated 27 Feb 2015sharpsharpensharplyshave   An action that is to remove one's hair, especially to remove men's facial hair. last updated 26 Feb 2015http://en.wikipedia.org/wiki/Shaving
 last updated 26 Feb 2015Shchyolkovoshe   A singular third person representation of the female subject thing of a verb that is refered to other already mentioned thing, girl, woman, or femal animal by one's speaking or writing. last updated 05 Mar 2015https://en.wikipedia.org/wiki/She
 last updated 05 Mar 2015shearSheberghanshedsheep   sheep" is something which is an animal that is a bovid ruminant mammal with transversely ribbed horns, a narrow face and a thick woolly coat . last updated 22 Mar 2015http://en.wikipedia.org/wiki/Sheep
 last updated 22 Mar 2015sheepishlysheet   Another name for flat sheet. last updated 30 Jan 2016https://en.wikipedia.org/wiki/Bedding
 last updated 30 Jan 2016SheffieldSheikhu Purasheldrake   sheldrake" is something which is a bird that is a large goose-like duck with usually brightly coloured plumage and black and white wings in flight. last updated 22 Mar 2015http://en.wikipedia.org/wiki/Shelduck
 last updated 22 Mar 2015shelfshell   The carapace of a tortoise, turtle, or terrapin that is the hard, rigid, outer calcareous covering or exoskeleton. last updated 31 Dec 2015https://en.wikipedia.org/wiki/Turtle_shell
 last updated 31 Dec 2015shelter   A physical structural object that is a building which is designed to provide or give temporary cover or protection from bad weather,  danger or attrack; place of refuge for people or things as a place of refuge. last updated 03 Apr 2015http://en.wikipedia.org/wiki/Shelter_%28building%29
 last updated 03 Apr 2015ShenyangShenzhenSheopurSherbrookesheriff   A person who is an official officer being in charge of performing the orders of the law courts and enforcing the law in a county last updated 26 Mar 2015http://en.wikipedia.org/wiki/Sheriff
 last updated 26 Mar 2015shhShibin el-KomshieldShiheziShihungShijiazhuangShikarpurshillingShillongShimizuShimlashimmeringShimogaShimonosekishineshiningshinyShinyangaship   ship" is something which is a boat that is large in size for transporting things by sea. last updated 17 Mar 2015http://en.wikipedia.org/wiki/Ship
 last updated 17 Mar 2015ShirazshirtShishi CityShishoushivershiveringShivpuriShiyanShizuishanShizuokaShkodërshoalshockshockingshoe   shoe" is something which is an object that is an outer shaped covering for fitting a foot with a stiff or sturdy bottom sole usually attached with a thicker heel and an upper part that covers part or all of the top of the foot especially ending not below or reaching above the ankle, and is made of leather, plastic, or synthetic material. last updated 26 Mar 2015http://en.wikipedia.org/wiki/Shoe
 last updated 26 Mar 2015shoemaker   A person who makes or repairs shoes or footwear as a profession. last updated 18 Mar 2015http://en.wikipedia.org/wiki/Shoemaking
 last updated 18 Mar 2015shoesshootshopshoreshortshortenshortsshouldshouldershoutshoutingshowshower   shower" is something which is a collection of something that are gathered together with profession of atmosphere or weather last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015Shreveport, Louisianashrewdshrewdnessshrillshrillyshrimp   shrimp" is something which is an animal that is a small marine decapod crustacean or shellfish with a thin shell, a slender flattened body, ten legs, a long tail and a single pair of pincers. last updated 25 Mar 2015http://en.wikipedia.org/wiki/Shrimp
 last updated 25 Mar 2015shrinkshrivelshrub   shrub" is something which is a plant that is a woody perennial plant, smaller than a tree, with several major branches arising from near the base of the main stem or directly from the ground. last updated 27 Mar 2015http://en.wikipedia.org/wiki/Shrub
 last updated 27 Mar 2015shrubberyshrugShuangchengShuangyashanShubra al KhaymahshuffleShuozhoushutshyshylyShymkentSialkoteSibiusibling   A male or female person who is one's brother or sister. last updated 20 Feb 2015http://en.wikipedia.org/wiki/Sibling
 last updated 20 Feb 2015Sibusicksickness   sickness" is something which is the concept of a condition that is the ill health state of a person whose body is not in sound condition or the condition of being ill. last updated 28 Feb 2015http://en.wikipedia.org/wiki/Sickness_behavior
 last updated 28 Feb 2015side   side" is something which is a collection of something that are gathered together as a team side by side. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015   An abstract concept of a border of the boundary of something that is the edge or extremity of something. last updated 15 Apr 2015http://en.wikipedia.org/wiki/Edge_%28geometry%29
 last updated 15 Apr 2015sidewalkSidi-bel-AbbèssiegeSiegenSieverodonetsksighsightsignsignalsignaturesignificantSiirtSikarSilang, CaviteSilay CitySilcharsilencesilentsilentlysilicon   A 'mass' thing this a chemical element of symbol Si, atomic number 14, and atomic weight [28.08, 28.09]. last updated 16 Feb 2015http://en.wikipedia.org/wiki/Silicon
 last updated 16 Feb 2015   as modifier using or relating to the abstract concept of silicon. last updated 07 Jan 2016http://en.wikipedia.org/wiki/Silicon
 last updated 16 Feb 2015Siligurisilk   The 'mass' thing of a very fine, strong, soft, lustrous fibre produced by silkworms and is used to make thread and fabric. last updated 21 Dec 2015https://en.wikipedia.org/wiki/Silk
 last updated 21 Dec 2015silkysillysilver   A 'mass' thing this a chemical element of symbol Ag, atomic number 47, and atomic weight 107.9. last updated 16 Feb 2015http://en.wikipedia.org/wiki/Silver
 last updated 16 Feb 2015silverware   The 'mass' thing of tableware articles collectively that are used for serving food and drink, such as dishes, teapots, containers, forks, knives, spoons, or cutlery, etc. and are made of or coated with silver. last updated 28 Jan 2016https://en.wikipedia.org/wiki/Household_silver
 last updated 28 Jan 2016SimferopolSimi Valley, CaliforniasimilarSimon   A name that is used as a given name to name a male person at birth as a part of one's full name and is not the family name. last updated 27 Feb 2015http://en.wikipedia.org/wiki/Simon_(given_name)
 last updated 27 Feb 2015simplesimplicity   simplicity" is something which is a collection of something that are gathered together with character of innocence. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015simplifysimplisticsinsinceSincelejosinceresingSingapore   A proper name that is used to name a country, officially the Republic of Singapore, composed of the island of Singapore and other small islands in Southeast Asia. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Singapore
 last updated 26 Jan 2016singer   A person who is sings as a profession or an occupation. last updated 20 Mar 2015http://en.wikipedia.org/wiki/Singing
 last updated 20 Mar 2015single   A person who is unmarried. last updated 21 Feb 2015http://en.wikipedia.org/wiki/Marriage
 last updated 21 Feb 2015single-father   A male person who is one's father but no wife lives with. last updated 20 Feb 2015http://en.wikipedia.org/wiki/Single_parent
 last updated 20 Feb 2015single-mother   A female person who is one's mother but no husband. last updated 20 Feb 2015http://en.wikipedia.org/wiki/Single_parent
 last updated 20 Feb 2015single-parent   A person who is one's father or mother but has no wife or husband lives with. last updated 20 Feb 2015http://en.wikipedia.org/wiki/Single_parent
 last updated 20 Feb 2015singularsinkSinuijiSioux Falls, South DakotasipSipingsirSirjanSirsasister   A female person who is the daughter of one's parents. last updated 20 Feb 2015http://en.wikipedia.org/wiki/Sibling
 last updated 20 Feb 2015sister-in-law   A female person who is the sister of one's spouse, or is the wife of one's brother, or is the wife of the brother of one's spouse. last updated 19 Feb 2015http://en.wikipedia.org/wiki/Sibling-in-law
 last updated 19 Feb 2015sitSitapurSittwesituationSivakasiSivasSivereksixsizesizzlingskateskeinskeletalskeletonsketchskiSkikdaskillskillfulskinskinnyskipskirlskirtSkopjeskulkskunk   skunk" is something which is an animal that is a musteline mammal with a black and white coat and bushy tail, and squirts a strong unpleasant-smelling fluid from the anal gland when threatened, attacked, fightened or in danger. last updated 25 Mar 2015http://en.wikipedia.org/wiki/Skunk
 last updated 25 Mar 2015skyslacksslapslateslaveslavery   slavery" is something which is the concept of a civil relationship that is the condition when a person is fully control by another person with absolute power or the state of being a slave. last updated 27 Feb 2015http://en.wikipedia.org/wiki/Slavery
 last updated 27 Feb 2015slaysleeksleep   sleep" is something which is the concept of a condition that is the resting or natural state of a person whose body is not active and the mind is unconscious or the state of sleeping. last updated 27 Feb 2015http://en.wikipedia.org/wiki/Sleep
 last updated 27 Feb 2015sleepilysleepingsleepwearsleepysleetslendersleuthsliceslideslightslimslimyslingslinkslipslippersslipperyslitSlivenslopesloppyslothSloughSlovakia   A proper name that is used to name a country, officially the Slovak Republic, in central Europe. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Slovakia
 last updated 26 Jan 2016Slovenia   A proper name that is used to name a country, officially the Republic of Slovenia, in southeastern Europe. last updated 03 Mar 2015https://en.wikipedia.org/wiki/Slovenia
 last updated 26 Jan 2016SlovianskslowslowlySłupsksmacksmallsmartsmashSmederevosmellsmellysmeltsmilesmilingsmitesmoggysmokeSmolensksmoothsmoothlysmuthsnail   snail" is something which is an animal that is a small terrestrial or freshwater gastropod mollusc with a spirally coiled round shell on the back, and moves very slowly and lives in water or on land. last updated 22 Mar 2015http://en.wikipedia.org/wiki/Snail
 last updated 22 Mar 2015snake   snake" is something which is an animal that is a limbless reptile with a long cylindrical body, no eyelids, a short tail, and extensible jaws for swallowing large prey. last updated 18 Mar 2015http://en.wikipedia.org/wiki/Snake
 last updated 18 Mar 2015snappysnatchsneaksneakerssneakysneersneezesniffsnipe   snipe" is something which is a bird that is a wading bird of marshes and wet meadows with a long thin straight bill, brown camouflaged plumage and typically a drumming display flight. last updated 24 Mar 2015http://en.wikipedia.org/wiki/Snipe
 last updated 24 Mar 2015snobbishsnoresnottysnowsnowysoSoachasoaksoap   The 'mass' thing of a chemical substance that is made of natural oils or fats with sodium hydroxide or another strong alkali and is used with water for washing and cleaning. last updated 25 Dec 2015https://en.wikipedia.org/wiki/Soap
 last updated 25 Dec 2015SobralSochisocialsocietysocksockssodasodium   A 'mass' thing this a chemical element of symbol Na, atomic number 11, and atomic weight 22.99. last updated 16 Feb 2015http://en.wikipedia.org/wiki/Sodium
 last updated 16 Feb 2015sofa   A piece of comfortable seating furniture that usually has a back and armrests, and is an upholstered seat on which a person can sit or down, or more than one person can sit at the same time. last updated 05 Jan 2016https://en.wikipedia.org/wiki/Couch
 last updated 05 Jan 2016SofiasoftsoftensoftlySogamososoggysoilSokaSolapursoldier   A person who is in the military and one serves or has served in an army. last updated 17 Mar 2015http://en.wikipedia.org/wiki/Soldier
 last updated 17 Mar 2015SoledadsolemnsolemnlysolidsolidlySolihullSolikamskSolingensolutionsolveSomalia   A proper name that is used to name a country, officially the Federal Republic of Somalia, in East Africa. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Somalia
 last updated 26 Jan 2016sombersomesomebodysomehowsomeonesomethingsometimesometimessomewhereson   A male person and is one's child. last updated 20 Feb 2015http://en.wikipedia.org/wiki/Son
 last updated 20 Feb 2015songSongkhlaSongyuanson-in-law   A male person who is the husband of one's daughter. last updated 20 Feb 2015http://en.wikipedia.org/wiki/Affinity_(law)
 last updated 20 Feb 2015SonipatsoonsoothesoothsaysophisticatedsordsordidsoreSorocabasorrowsorrySorsogon CitysortSosnowiecSouk Ahrassoulsoundsoundersoupsoup bowl   A large shallow bowl that is usually a round bowl of nine to ten inches in diameter with a flanged rim of width one to two inches and a well of depth up to one and a half inches, and is chiefly used to serve an individual portion of soup. last updated 08 Jan 2016https://en.wikipedia.org/wiki/Bowl
 last updated 08 Jan 2016soup spoon   A spoon that is a spoon with a large or round bowl, and is usually used for eating soup. last updated 28 Jan 2016https://en.wikipedia.org/wiki/Soup_spoon
 last updated 28 Jan 2016soursouth   south" is something which is a solid direction that is towards the part of the Earth below the equator. last updated 25 Feb 2015http://en.wikipedia.org/wiki/South
 last updated 25 Feb 2015South Bend, IndianaSouth Dum DumSouthamptonsoutheast   southeast" is something which is a solid direction that is towards the part of the Earth halfway between south and east. last updated 25 Feb 2015http://en.wikipedia.org/wiki/Cardinal_direction#Additional_points
 last updated 25 Feb 2015Southend on Seasouth-southeast   south-southeast" is something which is a solid direction that is towards the part of the Earth halfway between south and southeast. last updated 25 Feb 2015http://en.wikipedia.org/wiki/Points_of_the_compass
 last updated 25 Feb 2015south-southwest   south-southwest" is something which is a solid direction that is towards the part of the Earth halfway between south and southwest. last updated 25 Feb 2015http://en.wikipedia.org/wiki/Points_of_the_compass
 last updated 25 Feb 2015southwest   southwest" is something which is a solid direction that is towards the part of the Earth halfway between south and west. last updated 25 Feb 2015http://en.wikipedia.org/wiki/Cardinal_direction#Additional_points
 last updated 25 Feb 2015sowSowetosowndersowseSoyapangospacespacecraft   A physical device that is designed and used for travelling in outer space. last updated 14 Apr 2015http://en.wikipedia.org/wiki/Spacecraft
 last updated 14 Apr 2015spacesuit   A special kind of clothing that is a suit equipped a type of life support system for allowing an astronaut to survive in outer space when working outside of the spacecraft. last updated 14 Apr 2015http://en.wikipedia.org/wiki/Space_suit
 last updated 14 Apr 2015spaciousspadeSpain   A proper name that is used to name a country, officially the Kingdom of Spain, in western Europe. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Spain
 last updated 26 Jan 2016spanSpanishsparesparksparklesparklingsparrow   sparrow" is something which is a bird that is a small weaverbird with a brown or grey plumage . last updated 24 Mar 2015http://en.wikipedia.org/wiki/Sparrow
 last updated 24 Mar 2015sparsespeakspeaker   An electroacoustic transducer that is a piece of electrical device used to convert an electrical audio signal into a corresponding sound. last updated 05 Jan 2016https://en.wikipedia.org/wiki/Full-range_speaker
 last updated 06 Jan 2016   short for loudspeaker last updated 06 Jan 2016https://en.wikipedia.org/wiki/Loudspeaker
 last updated 06 Jan 2016specialspeciesspecifyspeckspectacularspeechspeechlessspeedspeedilyspeedingspellspendsphere   An abstract concept of a three dimensional geometric figure that is the geometric form of an solid object bounded by one surface boundaries or sides obtained by turning a semicircle a full 360 degree rotation with the diameter as the rotating axis in three dmensional space. last updated 17 Apr 2015http://en.wikipedia.org/wiki/Sphere
 last updated 17 Apr 2015sphericalspicyspider   spider" is something which is an animal that is a predatory arachnid with an unsegmented body, a fused head and thorax, a rounded abdomen and eight legs, and creates a web of sticky threads for catching insects and injects poison by fangs to kill prey. last updated 20 Mar 2015http://en.wikipedia.org/wiki/Spider
 last updated 20 Mar 2015spiffyspikyspillspinspinachspiritspiritualspitspitespitefulsplendidSplitsplitspoilSpokane, Washingtonspongespookyspoonspoonfulsportspotspotlessspottedspottysprayspread   spread" is something which is a collection of something that are gathered together over a large area. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015spring   spring" is something which is a collection of something that are gathered together with character of spring acting. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015Springfield, IllinoisSpringfield, MassachusettsSpringfield, MissouriSpringssproutspuriousspysquabblesquadsquadronsqualidsquare   An abstract concept of a two dimensional geometric figure that is a plane shape with four straight sides of equal length forming four internal right angles to each other. last updated 15 Apr 2015http://en.wikipedia.org/wiki/Square
 last updated 15 Apr 2015squashsqueaksquealsquealingsqueamishsqueezesquid   A marine fast-moving cephalopod mollusc that has a long, thin, soft torpedo-shaped body, eight arms and two long tentacles arround the mouth, and a pair of triangular tail fins. last updated 31 Dec 2015https://en.wikipedia.org/wiki/Squid
 last updated 31 Dec 2015squigglysquirrel   squirrel" is something which is an animal that is a smallarboreal sciurine rodent with a bushy tail, soft fur, and lives in trees, moves fast and feeds on nuts, seeds. last updated 20 Mar 2015http://en.wikipedia.org/wiki/Squirrel
 last updated 20 Mar 2015SrinagarSt HelensSt Louis, MissouriSt Paul, MinnesotaSt Petersburg, FloridaSt. CatharinesSt. John'sstabstablestackstaff   staff" is something which is a collection of something that are gathered together and work for the same organization. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015stagestainstair   stair" is something which is a thing that is one of the structure of steps in a set of steps for passing from one level or floor of a building to another. last updated 22 Mar 2015http://en.wikipedia.org/wiki/Stairs
 last updated 22 Mar 2015Stakhanovstakingstalestalkstalker   A person who is illegally following and watching someone, especially a woman, over a period of time. last updated 23 Mar 2015http://en.wikipedia.org/wiki/Stalking
 last updated 23 Mar 2015stamenStamford, Connecticutstampstand   stand" is something which is a collection of something that are gathered or grouped together with a standing like position. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015standardstandingstar   A physical celestial object that is a visible celestial object in the clear night sky as a point of light in space. last updated 21 Mar 2015http://en.wikipedia.org/wiki/Star
 last updated 21 Mar 2015Stara Zagorastarestarfish   A marine invertebrate echinoderm that has a flattened body, a mouth on the lower surface of the body center, five or more radiating arms from body disc center in the shape of a star, tube feet on the undersides of the arms. last updated 30 Dec 2015https://en.wikipedia.org/wiki/Starfish
 last updated 30 Dec 2015starling   starling" is something which is a bird that is a gregarious passerine songbird with black or dark brown plumage and a short tail, and lives in large groups. last updated 20 Mar 2015http://en.wikipedia.org/wiki/Starling
 last updated 20 Mar 2015Starsy Oskolstartstarvestate   state" is something which is a word or a group of words that is used to name the particular territory of the place at which someone lives. last updated 24 Feb 2015http://en.wikipedia.org/wiki/Federated_state
 last updated 24 Feb 2015statementstationstatistician   A person who studies or uses methods of theoretical or applied statistics to collect and analyze data for solving problems. last updated 24 Feb 2015http://en.wikipedia.org/wiki/Statistician
 last updated 24 Feb 2015statuestatuesqueStavangerStavropolstaysteadfaststeadystealstealthilysteam   steam" is something which is a collection of something that are gathered together with character of fast action. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015steamingsteel   The 'mass' material of a hard, strong, grey or bluish-grey metal alloy that is made of iron, and primarily carbon together with other chemical elements last updated 22 Dec 2015https://en.wikipedia.org/wiki/Steel
 last updated 22 Dec 2015   as modifier using or relating to the abstract concept of steel last updated 07 Jan 2016https://en.wikipedia.org/wiki/Steel
 last updated 22 Dec 2015steepsteerstemstepstepbrother   A male person who is not the son of one of one's birth parent, but is the child of the parent that one's birth parents has married. last updated 21 Feb 2015http://en.wikipedia.org/wiki/Stepfamily
 last updated 21 Feb 2015stepfather   A male person who is not one's birth father, but is the husband of one's birth mother. last updated 21 Feb 2015http://en.wikipedia.org/wiki/Stepfamily
 last updated 21 Feb 2015Stephen   A name that is used as a given name to name a male person at birth as a part of one's full name and is not the family name. last updated 27 Feb 2015http://en.wikipedia.org/wiki/Stephen
 last updated 27 Feb 2015   A name that is used as a given name to name a male person at birth as a part of one's full name and is not the family name. last updated 27 Feb 2015http://en.wikipedia.org/wiki/Stephen
 last updated 27 Feb 2015stepmother   A female person who is not one's birth mother, but is the wife of one's birth father. last updated 21 Feb 2015http://en.wikipedia.org/wiki/Stepfamily
 last updated 21 Feb 2015stepsister   A female person who is not the daughter of one of one's birth parent, but is the child of the parent that one's birth parents has married. last updated 21 Feb 2015http://en.wikipedia.org/wiki/Stepfamily
 last updated 21 Feb 2015stereotypedSterling Heights, MichiganSterlitamaksternlystewstickstickleback   stickleback" is something which is a fish that is a small scaleless teleost fish with two or more free spines in front of the dorsal fin along the back. last updated 25 Mar 2015http://en.wikipedia.org/wiki/Stickleback
 last updated 25 Mar 2015stickystiffstiffenstillstimulatestimulatingstingstingystinkstirstitchstoat   stoat" is something which is an animal that is a small carnivorous musteline mammal with a long thin body, a brown in summer or white in winter fur and a black-tipped tail. last updated 25 Mar 2015http://en.wikipedia.org/wiki/Stoat
 last updated 25 Mar 2015stockstockbroker   A person who buys and sells securities, stocks and shares on a stock exchange for and on behalf of clients, customers and other people and is on a commission basis usually. last updated 24 Mar 2015http://en.wikipedia.org/wiki/Stockbroker
 last updated 24 Mar 2015StockholmstockingstockingsStockportStockton, CaliforniaStoke-on-Trentstomachstonestopstorestork   stork" is something which is a bird that is a large wading bird with a long nect, a very long legs for walking around in water to find food, a long ltout pointed bill and white and black plumage. last updated 22 Mar 2015http://en.wikipedia.org/wiki/Stork
 last updated 22 Mar 2015stormstormystory   story" is something which is a piece of description that is used to describe or present a connected series of events in form of a sequence of pictures, written words, or spoken words. last updated 17 Mar 2015http://en.wikipedia.org/wiki/Narrative
 last updated 17 Mar 2015stoutstovestraightstraightenstrainstrangestrangerstrapStrasbourgstrawstrawberrystreakstream   steam" is something which is a collection of something that are gathered together with character of smooth motion. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015streamlinestreet   street" is something which is a word or a group of words that is used to name each particular path designated for public traffic as a unique name part in addition to address name. last updated 24 Feb 2015http://en.wikipedia.org/wiki/Street
 last updated 24 Feb 2015strengthstrengthenstretchstrictstrictlystridestrikestriker   A person who is an employee or work on strike or someone involved in a strike. last updated 26 Mar 2015http://en.wikipedia.org/wiki/Strike_action
 last updated 26 Mar 2015string   string" is something which is a collection of something that are grouped together with a string. last updated 01 Mar 2015http://en.wikipedia.org/wiki/Collective_noun
 last updated 01 Mar 2015stripstripestripedstrivestrokestrongstrontium   A 'mass' thing this a chemical element of symbol Sr, atomic number 38, and atomic weight 87.62. last updated 16 Feb 2015http://en.wikipedia.org/wiki/Strontium
 last updated 16 Feb 2015structurestrugglestrumpet   strumpet" is somebody who is a female person that is a female prostitute or a promiscuous woman. last updated 22 Mar 2015http://en.wikipedia.org/wiki/Prostitution
 last updated 22 Mar 2015stubbornnessstuckstudstudent   A person who is studying at a school, college, or university. last updated 20 Mar 2015http://en.wikipedia.org/wiki/Student
 last updated 20 Mar 2015studystuffstupendousstupidsturdyStuttgartsubaltern   A person who is a commissioned officer lower thantthe rank of captain in an army. last updated 27 Mar 2015http://en.wikipedia.org/wiki/Subaltern
 last updated 27 Mar 2015subduedsubjectsubletsubmarineSuboticasubsequentsubstancesubstantialsubstitutesubtletysubtractsubversionsucceedsuccesssuccessfulsuccessfullysuccinctSuceavasuchsuckSucreSudan   A proper name that is used to name a country, officially the Republic of the Sudan, in North Africa. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Sudan
 last updated 26 Jan 2016suddensuddenlySuezsuffersufficientsugarsugar bowl   A bowl-shaped vessel that usually has a cover and sometime with handles, and is used for serving sugar or sugar cubes. last updated 08 Jan 2016https://en.wikipedia.org/wiki/Sugar_bowl_%28dishware%29
 last updated 08 Jan 2016suggestsuggestionSuhajsuicideSuihuaSuiningsuitSuitasuitcase   suitcase" is something which is an object that is a large portable case with a handle and a hinged lid, usually stiffened and rectangular, for carrying clothing, belongings, etc while travelling. last updated 26 Mar 2015http://en.wikipedia.org/wiki/Suitcase
 last updated 26 Mar 2015SuizhouSukabumiSukkurSulamaniyasulfur   A 'mass' thing this a chemical element of symbol S, atomic number 16, and atomic weight [32.05, 32.08]. last updated 16 Feb 2015http://en.wikipedia.org/wiki/Sulfur
 last updated 16 Feb 2015sulkySullanaSultan Kudarat, MaguindanaoSultanbeyliSumaréSumgaitsummarizesummerSumySun   A physical celestial object that is the star at the centre of the Solar System which the Earth moves around as the orbit center and receives light or heat from. last updated 03 Apr 2015http://en.wikipedia.org/wiki/Sun
 last updated 03 Apr 2015sun   A physical celestial object that is the star at the centre of the Solar System in a general sence which the Earth moves around as the orbit center and receives light or heat from. last updated 03 Apr 2015http://en.wikipedia.org/wiki/Sun
 last updated 03 Apr 2015Suncheon, South KoreaSunderlandSundsvallsunflowerSungai Petanisunlight   The light 'mass' matter including infrared, visible, and ultraviolet in general sense that comes from the Sun through Earth's atmoshphere. last updated 21 Dec 2015https://en.wikipedia.org/wiki/Sunlight
 last updated 21 Dec 2015sunnySunnyvale, CaliforniaSunshine CoastsupersuperbsuperficialsuperfluitysupervisesuppersupplysupportsupposesuppresssupremeSuqianSurabayaSurakartaSuratSurat ThanisuresurfacesurfeitSurgutSurigao CitySuriname   A proper name that is used to name a country, officially the Republic of Suriname, in South America. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Suriname
 last updated 26 Jan 2016surname   surname" is something which is a word or a group of words that is used to name the family of a person as a part of one's full name. last updated 24 Feb 2015http://en.wikipedia.org/wiki/Family_name
 last updated 24 Feb 2015surplussurprisesurprisingsurprisinglysurrenderSurreysurroundsurveyor   A person who measures, examines, and records details of an' isas of land. last updated 24 Feb 2015http://en.wikipedia.org/wiki/Surveying
 last updated 24 Feb 2015survivesuspectsuspendsuspicionsuspicioussuspiciouslysuteSutton ColdfieldSuva, FijiSuwon, PuwanSuzanoSuzhou, AnhuiSuzhou, JiangsuSuzukasvelteswallow   swallow" is something which is a bird that is a small migratory passerine oscine songbird with short bill, long pointed wings, a deeply forked tail, short legs, and a rapid flight last updated 22 Mar 2015http://en.wikipedia.org/wiki/Swallow
 last updated 22 Mar 2015swan   swan" is something which is a bird that is a large aquatic bird with a long neck and lives on rivers or lakes. last updated 17 Mar 2015http://en.wikipedia.org/wiki/Swan
 last updated 17 Mar 2015swankySwanseaswarmSwaziland   A proper name that is used to name a country, officially the Kingdom of Swaziland, in Southern Africa. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Swaziland
 last updated 26 Jan 2016swearsweatsweatbandsweatersweatshirtSweden   A proper name that is used to name a country, officially the Kingdom of Sweden, in northern Europe. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Sweden
 last updated 26 Jan 2016sweepsweetsweetensweetlysweet-smellingswellswelteringswift   swift" is something which is a bird that is a small swift-flying insectivorous bird that with long narrow curved pointed wings and spend most of the time on the wing last updated 22 Mar 2015http://en.wikipedia.org/wiki/Swift
 last updated 22 Mar 2015swiftlyswimSwindonswine   swine" is something which is an animal that is another name of a pig, or a domesticated stout-bodied short-legged omnivorous artiodactyl mammal. last updated 22 Mar 2015http://en.wikipedia.org/wiki/Domestic_pig
 last updated 22 Mar 2015swingswingingswitchSwitzerland   A proper name that is used to name a country, officially the Swiss Confederation, in central Europe. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Switzerland
 last updated 26 Jan 2016swordswordfish   swordfish" is something which is a fish that is a large edible scombroid fish with a streamlined body and a very long flattened pointed sword-like upper jaw. last updated 22 Mar 2015http://en.wikipedia.org/wiki/Swordfish
 last updated 22 Mar 2015SydneySyktyvkarsymbolizesympatheticsympatheticallysympathysymptomaticsyndicatesynonymoussynthesizesynthetic   Any chemical, substance, or material that is made or prepared by the combination of two or more part artificially. last updated 29 Dec 2015SyracuseSyracuse, New YorkSyria   A proper name that is used to name a country, officially the Syrian Arab Republic, in Western Asia. last updated 26 Jan 2016https://en.wikipedia.org/wiki/Syria
 last updated 26 Jan 2016systemsystemizeSyzranSzczecinSzegedSzékesfehérvár
 ©sideway
 
 ID: 130800097 Last Updated: 8/12/2013 Revision: 0 |  |